PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G37940.1
Common NameLOC102704865
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YB
Protein Properties Length: 262aa    MW: 28089.2 Da    PI: 6.8286
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G37940.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB172.93.4e-5430125297
         NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                   reqdr++Pianv+rim++vlPa+akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa++ lGf+dyvepl+vyl++yre+ege+
  OB02G37940.1  30 REQDRLMPIANVIRIMRRVLPAHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSRLGFDDYVEPLSVYLHRYREFEGES 125
                   89*******************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.8E-4927127IPR009072Histone-fold
SuperFamilySSF471135.12E-3832129IPR009072Histone-fold
PfamPF008084.1E-253699IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.0E-176381No hitNo description
PROSITE patternPS0068506682IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006158.0E-1782100No hitNo description
PRINTSPR006158.0E-17101119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MEAGYPGAAN GAAADGNNGG TQAAAAPAIR EQDRLMPIAN VIRIMRRVLP AHAKISDDAK  60
ETIQECVSEY ISFITGEANE RCQREQRKTI TAEDVLWAMS RLGFDDYVEP LSVYLHRYRE  120
FEGESRGVGV GVGVGAARGD HHHHHHHHVH AAGMSPMLKP RAQGSMATHH DMQMHAAMYG  180
GAVPPPPQPP PHHHAFLMPP HHSQYAPYDM YGGEHGMAAY YGGMYAPGTG GNGGDGSGSS  240
GSGGAGTPQT VNFDHQHPFG YK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A8e-4028120193NF-YB
4awl_B7e-4028120294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A7e-4028120294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4g91_B8e-4029120192Transcription factor HapC (Eurofung)
4g92_B8e-4029120192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880360.0AB288036.1 Oryza sativa Japonica Group OsHAP3E mRNA for HAP3 subunit of HAP complex, complete cds.
GenBankAK1078610.0AK107861.1 Oryza sativa Japonica Group cDNA clone:002-134-B07, full insert sequence.
GenBankAP0041790.0AP004179.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1124_G07.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAY2642840.0AY264284.1 Oryza sativa (indica cultivar-group) leafy cotyledon 1 gene, complete cds.
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647824.10.0PREDICTED: nuclear transcription factor Y subunit B-8-like
TrEMBLJ3LGM70.0J3LGM7_ORYBR; Uncharacterized protein
STRINGOB02G37940.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.27e-63nuclear factor Y, subunit B6